RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1889 domain-containing protein YoaC Amino Acid Sequence


Size: 99

Fasta

 

>DUF1889 domain-containing protein YoaC E. coli K12. Version NC_000913.3 GI:556503834
MPAVIDKALDFIGAMDVSAPTPSSMNESTAKGIFKYLKELGVPASAADITARADQEGWNP
GFTEKMVGWAKKMETGERSVIKNPEYFSTYMQEELKALV
              
                            

Download fasta file
RegulonDB