RegulonDB RegulonDB 10.9: Amino acid Sequence
UFP0181 family protein YoaH Amino Acid Sequence


Size: 59

Fasta

 

>UFP0181 family protein YoaH E. coli K12. Version NC_000913.3 GI:556503834
MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGERIVARFEDEDE
              
                            

Download fasta file
RegulonDB