RegulonDB RegulonDB 10.9: Amino acid Sequence
putative c-di-GMP phosphodiesterase PdeD Amino Acid Sequence


Size: 532

Fasta

 

>putative c-di-GMP phosphodiesterase PdeD E. coli K12. Version NC_000913.3 GI:556503834
MQKAQRIIKTYRRNRMIVCTICALVTLASTLSVRFISQRNLNQQRVVQFANHAVEELDKV
LLPLQAGSEVLLPLIGLPCSVAHLPLRKQAAKLQTVRSIGLVQDGTLYCSSIFGYRNVPV
VDILAELPAPQPLLRLTIDRALIKGSPVLIQWTPAAGSSNAGVMEMINIDLLTAMLLEPQ
LPQISSASLTVDKRHLLYGNGLVDSLPQPEDNENYQVSSQRFPFTINVNGPGATALAWHY
LPTQLPLAVLLSLLVGYIAWLATAYRMSFSREINLGLAQHEFELFCQPLLNARSQQCIGV
EILLRWNNPRQGWISPDVFIPIAEEHHLIVPLTRYVMAETIRQRHVFPMSSQFHVGINVA
PSHFRRGVLIKDLNQYWFSAHPIQQLILEITERDALLDVDYRIARELHRKNVKLAIDDFG
TGNSSFSWLETLRPDVLKIDKSFTAAIGSDAVNSTVTDIIIALGQRLNIELVAEGVETQE
QAKYLRRHGVHILQGYLYAQPMPLRDFPKWLAGSQPPPARHNGHITPIMPLR
              
                            

Download fasta file
RegulonDB