RegulonDB RegulonDB 10.9: Amino acid Sequence
intermembrane transport protein LetA Amino Acid Sequence


Size: 427

Fasta

 

>intermembrane transport protein YebS E. coli K12. Version NC_000913.3 GI:556503834
MALNTPQITPTKKITVRAIGEELPRGDYQRCPQCDMLFSLPEINSHQSAYCPRCQAKIRD
GRDWSLTRLAAMAFTMLLLMPFAWGEPLLHIWLLGIRIDANVMQGIWQMTKQGDAITGSM
VFFCVIGAPLILVTSIAYLWFGNRLGMNLRPVLLMLERLKEWVMLDIYLVGIGVASIKVQ
DYAHIQAGVGLFSFVALVILTTVTLSHLNVEELWERFYPQRPATRRDEKLRVCLGCHFTG
YPDQRGRCPRCHIPLRLRRRHSLQKCWAALLASIVLLLPANLLPISIIYLNGGRQEDTIL
SGIMSLASSNIAVAGIVFIASILVPFTKVIVMFTLLLSIHFKCQQGLRTRILLLRMVTWI
GRWSMLDLFVISLTMSLINRDQILAFTMGPAAFYFGAAVILTILAVEWLDSRLLWDAHES
GNARFDD
              
                            

Download fasta file
RegulonDB