RegulonDB RegulonDB 10.8: Amino acid Sequence
intermembrane transport protein YebT Amino Acid Sequence


Size: 877

Fasta

 

>intermembrane transport protein YebT E. coli K12. Version NC_000913.3 GI:556503834
MSQETPASTTEAQIKNKRRISPFWLLPFIALMIASWLIWDSYQDRGNTVTIDFMSADGIV
PGRTPVRYQGVEVGTVQDISLSDDLRKIEVKVSIKSDMKDALREETQFWLVTPKASLAGV
SGLDALVGGNYIGMMPGKGKEQDHFVALDTQPKYRLDNGDLMIHLQAPDLGSLNSGSLVY
FRKIPVGKVYDYAINPNKQGVVIDVLIERRFTDLVKKGSRFWNVSGVDANVSISGAKVKL
ESLAALVNGAIAFDSPEESKPAEAEDTFGLYEDLAHSQRGVIIKLELPSGAGLTADSTPL
MYQGLEVGQLTKLDLNPGGKVTGEMTVDPSVVTLLRENTRIELRNPKLSLSDANLSALLT
GKTFELVPGDGEPRKEFVVVPGEKALLHEPDVLTLTLTAPESYGIDAGQPLILHGVQVGQ
VIDRKLTSKGVTFTVAIEPQHRELVKGDSKFVVNSRVDVKVGLDGVEFLGASASEWINGG
IRILPGDKGEMKASYPLYANLEKALENSLSDLPTTTVSLSAETLPDVQAGSVVLYRKFEV
GEVITVRPRANAFDIDLHIKPEYRNLLTSNSVFWAEGGAKVQLNGSGLTVQASPLSRALK
GAISFDNLSGASASQRKGDKRILYASETAARAVGGQITLHAFDAGKLAVGMPIRYLGIDI
GQIQTLDLITARNEVQAKAVLYPEYVQTFARGGTRFSVVTPQISAAGVEHLDTILQPYIN
VEPGRGNPRRDFELQEATITDSRYLDGLSIIVEAPEAGSLGIGTPVLFRGLEVGTVTGMT
LGTLSDRVMIAMRISKRYQHLVRNNSVFWLASGYSLDFGLTGGVVKTGTFNQFIRGGIAF
ATPPGTPLAPKAQEGKHFLLQESEPKEWREWGTALPK
              
                            

Download fasta file
RegulonDB