RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1482 domain-containing protein YebW Amino Acid Sequence


Size: 63

Fasta

 

>DUF1482 domain-containing protein YebW E. coli K12. Version NC_000913.3 GI:556503834
MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY
GDF
              
                            

Download fasta file
RegulonDB