RegulonDB RegulonDB 10.9: Amino acid Sequence
Zn2+ ABC transporter ATP binding subunit Amino Acid Sequence


Size: 251

Fasta

 

>Zn2+ ABC transporter ATP binding subunit E. coli K12. Version NC_000913.3 GI:556503834
MTSLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLVTPDEGV
IKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRLRPGTHKEDILPALKRVQAGHLINAPMQK
LSGGETQRVLLARALLNRPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELDCGVLMVSHD
LHLVMAKTDEVLCLNHHICCSGTPEVVSLHPEFISMFGPRGAEQLGIYRHHHNHRHDLQG
RIVLRRGNDRS
              
                            

Download fasta file
RegulonDB