RegulonDB RegulonDB 10.9: Amino acid Sequence
MAPEG family inner membrane protein YecN Amino Acid Sequence


Size: 131

Fasta

 

>MAPEG family inner membrane protein YecN E. coli K12. Version NC_000913.3 GI:556503834
MVSALYAVLSALLLMKFSFDVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPIAIVL
MLFMEMNGAETWMVHICGIVLLAGRLMHYYGFHHRLFRWRRSGMSATWCALLLMVLANLW
YMPWELVFSLR
              
                            

Download fasta file
RegulonDB