RegulonDB RegulonDB 10.8: Amino acid Sequence
cytochrome c quinol dehydrogenase TorY Amino Acid Sequence


Size: 366

Fasta

 

>cytochrome c quinol dehydrogenase TorY E. coli K12. Version NC_000913.3 GI:556503834
MRGKKRIGLLFLLIAVVVGGGGLLLAQKVLHKTSDTAFCLSCHSMSKPFEEYQGTVHFSN
QKGIRAECADCHIPKSGMDYLFAKLKASKDIYHEFVSGKIDSDDKFEAHRQEMAETVWKE
LKATDSATCRSCHSFDAMDIASQSESAQKMHNKAQKDSETCIDCHKGIAHFPPEIKMDDN
AAHELESQAATSVTNGAHIYPFKTSHIGELATVNPGTDLTVVDASGKQPIVLLQGYQMQG
SENTLYLAAGQRLALATLSEEGIKALTVNGEWQADEYGNQWRQASLQGALTDPALADRKP
LWQYAEKLDDTYCAGCHAPIAADHYTVNAWPSIAKGMGARTSMSENELDILTRYFQYNAK
DITEKQ
              
                            

Download fasta file
RegulonDB