RegulonDB RegulonDB 10.9: Amino acid Sequence
universal stress protein C Amino Acid Sequence


Size: 142

Fasta

 

>universal stress protein C E. coli K12. Version NC_000913.3 GI:556503834
MSYSNILVAVAVTPESQQLLAKAVSIARPVKGHISLITLASDPEMYNQLAAPMLEDLRSV
MHEETQSFLDKLIQDAGYPVDKTFIAYGELSEHILEVCHKHHFDLVICGNHNHSFFSRAS
CSAKRVIASSEVDVLLVPLTGD
              
                            

Download fasta file
RegulonDB