RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2492 domain-containing protein YecH Amino Acid Sequence


Size: 79

Fasta

 

>DUF2492 domain-containing protein YecH E. coli K12. Version NC_000913.3 GI:556503834
MDSIHGHEVLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKG
KFIPSKDGFSTDQSKICRH
              
                            

Download fasta file
RegulonDB