RegulonDB RegulonDB 10.8: Amino acid Sequence
putative type III secreted effector, N-terminal fragment Amino Acid Sequence


Size: 375

Fasta

 

>putative type III secreted effector, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MFPLNDLSLKTQPVQLNKVTSNTESTIKQHELVSDDAIINELSSELVSCLGNGKFTPISE
DSKLFNMLSEFKLLHSEYFEWGDYSLWFQDFSIYNKIGFIMIEKIRELVTHPFGIN*SLY
RLILQSF*TTLRKLQIPDFAKVSATGLIQ*KKAHRMTSKKMWI*HW*DCLNVLNSTIVNL
T*QIFTWGLCHLFHPGLRCFIFVIMALPQYKFPNSAKN*SSISIIIWYFQKYPMELPRSP
*III*YRVLTHLRQRL*QFLFIAIKYGKYQQCLRLLSCLIVAIIR*KKFNTSQIIWRKHV
WSVILRLSLRYIAIKNYFLKNVILLKRHFYIMDFDRDLL*KIAAKIYCYESR*L**IFRY
G*KVCNRW*GTHN*I
              
                            

Download fasta file
RegulonDB