RegulonDB RegulonDB 11.0: Amino acid Sequence
putative mannosyl-3-phosphoglycerate phosphatase Amino Acid Sequence


Size: 271

Fasta

 

>putative mannosyl-3-phosphoglycerate phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MFSIQQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKT
LGLQGLPLIAENGAVIQLAEQWQEIDGFPRIISGISHGEISLVLNTLREKEHFKFTTFDD
VDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQFTARLNELGLQFMQGARFWH
VLDASAGKDQAANWIIATYQQLSGKRPTTLGLGDGPNDAPLLEVMDYAVIVKGLNREGVH
LHDEDPARVWRTQREGPEGWREGLDHFFSAR
              
                            

Download fasta file
RegulonDB