RegulonDB RegulonDB 10.9: Amino acid Sequence
putative diguanylate cyclase DgcQ Amino Acid Sequence


Size: 564

Fasta

 

>putative diguanylate cyclase DgcQ E. coli K12. Version NC_000913.3 GI:556503834
MQHETKMENQSWLKKLARRLGPGHVVNLCFIVVLLFSTLLTWREVVVLEDAYISSQRNHL
ENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRDAVTEFEQHRDEHAWKIELNR
RRTLPVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAMYVSRA
GFYVSTQPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQPEHASNTEPQVTV
SVPVDSNNYWYGVLGMSIPVRTMQQFLRNAIDKNLDGEYQLYDSKLRFLTSSNPDHPTGN
IFDPRELALLAQAMEHDTRGGIRMDSRYVSWERLDHFDGVLVRVHTLSEGVRGDFGSISI
ALTLLWALFTTMLLISWYVIRRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLA
KLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEE
FCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQ
SLADRRLYLAKQAGRNRVFASDNA
              
                            

Download fasta file
RegulonDB