RegulonDB RegulonDB 10.9: Amino acid Sequence
putative outer membrane protein YedS, N-terminal fragment Amino Acid Sequence


Size: 396

Fasta

 

>putative outer membrane protein YedS, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MKRKVLAMLVPALLVAGAANAAEVYNKDGNKLDLYGKVVGLHYFSDDSGSDGDMSYARIG
FKGETQIADQFTGYGQWEFNIGANGPESDKGNTATRLAFAGLGFGQNGTFDYGRNYGVVY
DVEAWTDMLPEFGGDTYAGADNFMNGRANGVATYRNNGFFG*VDGLNFALQYQGNNESGG
PFGQEGSGSGDGRSLSKENGDGFGMSTSYDFDFGLSLGAAYQTLIVQIVRLELV*MIVTI
ATEMLVVKPLKHGLLVQNMMLIMCI*QLCTLKLAI*PHMVVASLIMVNQDQPSLTKPKTL
KLLLSISSTLACARPSLTCNLKVRI*AVGLMTATATHVTPIKIWLNTLILVRPTTSTKTC
PPMLITKSTCWTTTMTSTKQTASLPMISLLWA*STS
              
                            

Download fasta file
RegulonDB