RegulonDB RegulonDB 10.9: Amino acid Sequence
hydroxyisourate hydrolase / transthyretin-related protein Amino Acid Sequence


Size: 137

Fasta

 

>hydroxyisourate hydrolase / transthyretin-related protein E. coli K12. Version NC_000913.3 GI:556503834
MLKRYLVLSVATAAFSLPSLVNAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQL
NTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHY
HVPLLLSQYGYSTYRGS
              
                            

Download fasta file
RegulonDB