RegulonDB RegulonDB 10.10: Amino acid Sequence
inverse autotransporter adhesin Amino Acid Sequence


Size: 2358

Fasta

 

>inverse autotransporter adhesin E. coli K12. Version NC_000913.3 GI:556503834
MATKKRSGEEINDRQILCGMGIKLRRLTAGICLITQLAFPMAAAAQGVVNAATQQPVPAQ
IAIANANTVPYTLGALESAQSVAERFGISVAELRKLNQFRTFARGFDNVRQGDELDVPAQ
VSEKKLTPPPGNSSDNLEQQIASTSQQIGSLLAEDMNSEQAANMARGWASSQASGAMTDW
LSRFGTARITLGVDEDFSLKNSQFDFLHPWYETPDNLFFSQHTLHRTDERTQINNGLGWR
HFTPTWMSGINFFFDHDLSRYHSRAGIGAEYWRDYLKLSSNGYLRLTNWRSAPELDNDYE
ARPANGWDVRAESWLPAWPHLGGKLVYEQYYGDEVALFDKDDRQSNPHAITAGLNYTPFP
LMTFSAEQRQGKQGENDTRFAVDFTWQPGSAMQKQLDPNEVAARRSLAGSRYDLVDRNNN
IVLEYRKKELVRLTLTDPVTGKSGEVKSLVSSLQTKYALKGYNVEATALEAAGGKVVTTG
KDILVTLPAYRFTSTPETDNTWPIEVTAEDVKGNLSNREQSMVVVQAPTLSQKDSSVSLS
TQTLNADSHSTATLTFIAHDAAGNPVVGLVLSTRHEGVQDITLSDWKDNGDGSYTQILTT
GAMSGTLTLMPQLNGVDAAKAPAVVNIISVSSSRTHSSIKIDKDRYLSGNPIEVTVELRD
ENDKPVKEQKQQLNNAVSIDNVKPGVTTDWKETADGVYKATYTAYTKGSGLTAKLLMQNW
NEDLHTAGFIIDANPQSAKIATLSASNNGVLANENAANTVSVNVADEGSNPINDHTVTFA
VLSGSATSFNNQNTAKTDVNGLATFDLKSSKQEDNTVEVTLENGVKQTLIVSFVGDSSTA
QVDLQKSKNEVVADGNDSVTMTATVRDAKGNLLNDVMVTFNVNSAEAKLSQTEVNSHDGI
ATATLTSLKNGDYRVTASVSSGSQANQQVNFIGDQSTAALTLSVPSGDITVTNTAPQYMT
ATLQDKNGNPLKDKEITFSVPNDVASKFSISNGGKGMTDSNGVAIASLTGTLAGTHMIMA
RLANSNVSDAQPMTFVADKDRAVVVLQTSKAEIIGNGVDETTLTATVKDPSNHPVAGITV
NFTMPQDVAANFTLENNGIAITQANGEAHVTLKGKKAGTHTVTATLGNNNTSDSQPVTFV
ADKASAQVVLQISKDEITGNGVDSATLTATVKDQFDNEVNNLPVTFSSASSGLTLTPGVS
NTNESGIAQATLAGVAFGEKTVTASLANNGASDNKTVHFIGDTAAAKIIELAPVPDSIIA
GTPQNSSGSVITATVVDNNGFPVKGVTVNFTSNAATAEMTNGGQAVTNEQGKATVTYTNT
RSSIESGARPDTVEASLENGSSTLSTSINVNADASTAHLTLLQALFDTVSAGETTSLYIE
VKDNYGNGVPQQEVTLSVSPSEGVTPSNNAIYTTNHDGNFYASFTATKAGVYQLTATLEN
GDSMQQTVTYVPNVANAEITLAASKDPVIADNNDLTTLTATVADTEGNAIANTEVTFTLP
EDVKANFTLSDGGKVITDAEGKAKVTLKGTKAGAHTVTASMTGGKSEQLVVNFIADTLTA
QVNLNVTEDNFIANNVGMTRLQATVTDGNGNPLANEAVTFTLPADVSASFTLGQGGSAIT
DINGKAEVTLSGTKSGTYPVTVSVNNYGVSDTKQVTLIADAGTAKLASLTSVYSFVVSTT
EGATMTASVTDANGNPVEGIKVNFRGTSVTLSSTSVETDDRGFAEILVTSTEVGLKTVSA
SLADKPTEVISRLLNASADVNSATITSLEIPEGQVMVAQDVAVKAHVNDQFGNPVAHQPV
TFSAEPSSQMIISQNTVSTNTQGVAEVTMTPERNGSYMVKASLPNGASLEKQLEAIDEKL
TLTASSPLIGVYAPTGATLTATLTSANGTPVEGQVINFSVTPEGATLSGGKVRTNSSGQA
PVVLTSNKVGTYTVTASFHNGVTIQTQTTVKVTGNSSTAHVASFIADPSTIAATNTDLST
LKATVEDGSGNLIEGLTVYFALKSGSATLTSLTAVTDQNGIATTSVKGAMTGSVTVSAVT
TAGGMQTVDITLVAGPADTSQSVLKSNRSSLKGDYTDSAELRLVLHDISGNPIKVSEGME
FVQSGTNVPYIKISAIDYSLNINGDYKATVTGGGEGIATLIPVLNGVHQAGLSTTIQFTR
AEDKIMSGTVSVNGTDLPTTTFPSQGFTGAYYQLNNDNFAPGKTAADYEFSSSASWVDVD
ATGKVTFKNVGSNSERITATPKSGGPSYVYEIRVKSWWVNAGEAFMIYSLAENFCSSNGY
TLPRANYLNHCSSRGIGSLYSEWGDMGHYTTDAGFQSNMYWSSSPANSSEQYVVSLATGD
QSVFEKLGFAYATCYKNL
              
                            

Download fasta file
RegulonDB