RegulonDB RegulonDB 10.9: Amino acid Sequence
putative glycosyltransferase, N-terminal fragment Amino Acid Sequence


Size: 350

Fasta

 

>putative glycosyltransferase, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MFLASLLRRIAFSYYDYKAYNFNIEKTDFVVIHIPDQIGDAMAIFPVIRALELHKIKHLL
IVTSTINLEVFNALKLEQTKLTLVTMTMQDHATLKEIKDLAKNITQQYGTPDLCIEGMRK
KNLKTMLFISQLKAKTNFQVVGITMNCFSPLCKNASSMDQKLRAPVPMTWAFMMREAGFP
AVRPIYELPLSEDVLDEVREEMRSLGSYIAFNLEGSSQERTFSLSIAENLIAKI*SETDI
PIVIVHGPKGEDKARALVDCYNNVYRLSLPPSIKRSAAIIKDAYIAITPDTSILHMASAY
NTPVVAIYADYKTRWPAMADVSESVVVGQKIDNISLDEFAKALKSVLARI
              
                            

Download fasta file
RegulonDB