RegulonDB RegulonDB 10.9: Amino acid Sequence
L,D-transpeptidase LdtA Amino Acid Sequence


Size: 310

Fasta

 

>L,D-transpeptidase LdtA E. coli K12. Version NC_000913.3 GI:556503834
MRRVNILCSFALLFASHTSLAVTYPLPPEGSRLVGQSFTVTVPDHNTQPLETFAAQYGQG
LSNMLEANPGADVFLPKSGSQLTIPQQLILPDTVRKGIVVNVAEMRLYYYPPDSNTVEVF
PIGIGQAGRETPRNWVTTVERKQEAPTWTPTPNTRREYAKRGESLPAFVPAGPDNPMGLY
AIYIGRLYAIHGTNANFGIGLRVSQGCIRLRNDDIKYLFDNVPVGTRVQIIDQPVKYTTE
PDGSNWLEVHEPLSRNRAEYESDRKVPLPVTPSLRAFINGQEVDVNRANAALQRRSGMPV
QISSGSRQMF
              
                            

Download fasta file
RegulonDB