RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-44 prophage; IS5 transposase and trans-activator Amino Acid Sequence


Size: 326

Fasta

 

>CP4-44 prophage; IS5 transposase and trans-activator E. coli K12. Version NC_000913.3 GI:556503834
MFVIWSHGTGFIMSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKA
GNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNF
RHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPEMHQTK
KGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQ
REELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRAKVEHPFRIIKRQFGF
VKARYKGLLKNDNQLAMLFTLANLFRADQMIRQWERSH
              
                            

Download fasta file
RegulonDB