RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-44 prophage; putative GTP-binding protein Amino Acid Sequence


Size: 141

Fasta

 

>CP4-44 prophage; putative GTP-binding protein E. coli K12. Version NC_000913.3 GI:556503834
MVTQADKTEPCHEWDMAGIQPSPAQAQNIREKTEAVFRLFRPVHPVVAVSARTGWELDTL
VSALMTALPDHAASPLMTRLQDELRTESVRSQAREQFTGAVDRIFDTAESVCIASVARTV
LRAVRDTVVSVARAVWNWIFF
              
                            

Download fasta file
RegulonDB