RegulonDB RegulonDB 11.0: Amino acid Sequence
CP4-44 prophage; inner membrane protein YeeR Amino Acid Sequence


Size: 510

Fasta

 

>CP4-44 prophage; inner membrane protein YeeR E. coli K12. Version NC_000913.3 GI:556503834
MLQIVGALILLIAGFAILRLLFRALISTASALAGLILLCLFGPALLAGYITERITRLFHI
RWLAGVFLTIAGMIISFMWGLDGKHIALEAHTFDSVKFILTTALAGGLLAVPLQIKNIQQ
NGITPEDISKEINGYYCCFYTAFFLMACSACAPLIALQYDISPSLMWWGGLLYWLAALVT
LLWAASQIQALKKLTCAISQTLEEQPVLNSKSWLTSLQNDYSLPDSLTERIWLTLISQRI
SRGELREFELADGNWLLNNAWYERNMAGFNEQLKENLSFTPDELKTLFRNRLNLSPEAND
DFLDRCLDGGDWYPFSEGRRFVSFHHVDELRICASCGLTEVHHAPENHKPDPEWYCSSLC
RETETLCQEIYERPYNSFISDATANGLILMKLPETWSTNEKMFASGGQGHGFAAERGNHI
VDRVRLKNARILGDNNARNGADRLVSGTEIQTKYCSTAARSVGAAFDGQNGQYRYMGNNG
PMQLEVPRDQYAGAVETMRNKIREGKVEER
              
                            

Download fasta file
RegulonDB