RegulonDB RegulonDB 10.10: Amino acid Sequence
CP4-44 prophage; RadC-like JAB domain-containing protein YeeS Amino Acid Sequence


Size: 148

Fasta

 

>CP4-44 prophage; RadC-like JAB domain-containing protein YeeS E. coli K12. Version NC_000913.3 GI:556503834
MTPGERSLIQRALKTLDRHLHEPGVAFTSTRAAREWLILNMAGLEREEFRVLYLNNQNQL
IAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADRLITERLVQA
LGLVDIRVPDHLIVGGNQVFSFAEHGLL
              
                            

Download fasta file
RegulonDB