RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-44 prophage; DUF987 domain-containing protein YeeT Amino Acid Sequence


Size: 73

Fasta

 

>CP4-44 prophage; DUF987 domain-containing protein YeeT E. coli K12. Version NC_000913.3 GI:556503834
MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS
FGPYVRLMSVTLN
              
                            

Download fasta file
RegulonDB