RegulonDB RegulonDB 10.10: Amino acid Sequence
CP4-44 prophage; cytoskeleton-binding toxin CbtA Amino Acid Sequence


Size: 124

Fasta

 

>CP4-44 prophage; cytoskeleton-binding toxin CbtA E. coli K12. Version NC_000913.3 GI:556503834
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLC
DAVNFLVEKYALVRTDQPGFSACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKY
PEAK
              
                            

Download fasta file
RegulonDB