RegulonDB RegulonDB 10.10: Amino acid Sequence
CP4-44 prophage; putative uncharacterized protein YeeW Amino Acid Sequence


Size: 64

Fasta

 

>CP4-44 prophage; putative uncharacterized protein YeeW E. coli K12. Version NC_000913.3 GI:556503834
MMTLEADSVNVQALDMGHIVVDIDGVNITELINKAAENGYSLRVVDDRDSTETPATYASP
HQLL
              
                            

Download fasta file
RegulonDB