RegulonDB RegulonDB 10.9: Amino acid Sequence
M-antigen undecaprenyl disphosphate flippase Amino Acid Sequence


Size: 492

Fasta

 

>M-antigen undecaprenyl disphosphate flippase E. coli K12. Version NC_000913.3 GI:556503834
MSLREKTISGAKWSAIATVIIIGLGLVQMTVLARIIDNHQFGLLTVSLVIIALADTLSDF
GIANSIIQRKEISHLELTTLYWLNVGLGIVVCVAVFLLSDLIGDVLNNPDLAPLIKTLSL
AFVVIPHGQQFRALMQKELEFNKIGMIETSAVLAGFTCTVVSAHFWPLAMTAILGYLVNS
AVRTLLFGYFGRKIYRPGLHFSLASVAPNLRFGAWLTADSIINYLNTNLSTLVLARILGA
GVAGGYNLAYNVAVVPPMKLNPIITRVLFPAFAKIQDDTEKLRVNFYKLLSVVGIINFPA
LLGLMVVSNNFVPLVFGEKWNSIIPVLQLLCVVGLLRSVGNPIGSLLMAKARVDISFKFN
VFKTFLFIPAIVIGGQMAGAIGVTLGFLLVQIINTILSYFVMIKPVLGSSYRQYILSLWL
PFYLSLPTLVVSYALGIVLKGQLALGMLLAVQIATGVLAFVVMIVLSRHPLVVEVKRQFC
RSEKMKMLLRAG
              
                            

Download fasta file
RegulonDB