RegulonDB RegulonDB 10.9: Amino acid Sequence
UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase Amino Acid Sequence


Size: 464

Fasta

 

>UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase E. coli K12. Version NC_000913.3 GI:556503834
MTNLKKRERAKTNASLISMVQRFSDITIMFAGLWLVCEVSGLSFLYMHLLVALITLVVFQ
MLGGITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYALTS
IGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDP
KPGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIPDV
FTFNILHSRLEEMNGVPVVPLYDTPLSGVNRLLKRAEDIVLATLILLLISPVLCCIALAV
KLSSPGPVIFRQTRYGMDGKPIKVWKFRSMKVMENDKVVTQATQNDPRVTKVGNFLRRTS
LDELPQFINVLTGGMSIVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGITGWAQINGWRGE
TDTLEKMEKRVEFDLEYIREWSVWFDIKIVFLTVFKGFVNKAAY
              
                            

Download fasta file
RegulonDB