RegulonDB RegulonDB 10.9: Amino acid Sequence
colanic acid biosynthesis fucosyltransferase WcaE Amino Acid Sequence


Size: 248

Fasta

 

>colanic acid biosynthesis fucosyltransferase WcaE E. coli K12. Version NC_000913.3 GI:556503834
MLLSIITVAFRNLEGIVKTHASLAHLAQVEDISFEWIVVDGGSNDGTREYLENLNGIFNL
RFVSEPDNGIYDAMNKGIAMAQGKFALFLNSGDIFHQNAANFVRKLKMQKDNVMITGDAL
LDFGDGHKIKRSAKPGWYIYHSLPASHQAIFFPVSGLKKWRYDLEYKVSSDYALAAKMYK
AGYAFKKLNGLVSEFSMGGVSTTNNMELCADAKKVQRQILHVPGFWAELSWHLRQRTTSK
TKALYNKV
              
                            

Download fasta file
RegulonDB