RegulonDB RegulonDB 10.8: Amino acid Sequence
colanic acid biosynthesis glucuronosyltransferase WcaA Amino Acid Sequence


Size: 279

Fasta

 

>putative colanic acid biosynthesis glycosyl transferase WcaA E. coli K12. Version NC_000913.3 GI:556503834
MKNNPLISIYMPTWNRQQLAIRAIKSVLRQDYSNWEMIIVDDCSTSWEQLQQYVTALNDP
RITYIHNDINSGACAVRNQAIMLAQGEYITGIDDDDEWTPNRLSVFLAHKQQLVTHAFLY
ANDYVCQGEVYSQPASLPLYPKSPYSRRLFYKRNIIGNQVFTWAWRFKECLFDTELKAAQ
DYDIFLRMVVEYGEPWKVEEATQILHINHGEMQITSSPKKFSGYFHFYRKHKDKFDRASK
KYQLFTLYQIRNKRMTWRTLLTLLSVRNGKRLADGIRGR
              
                            

Download fasta file
RegulonDB