RegulonDB RegulonDB 10.9: Amino acid Sequence
outer membrane polysaccharide export protein Wza Amino Acid Sequence


Size: 379

Fasta

 

>outer membrane polysaccharide export protein Wza E. coli K12. Version NC_000913.3 GI:556503834
MMKSKMKLMPLLVSVTLISGCTVLPGSNMSTMGKDVIKQQDADFDLDKMVNVYPLTPRLI
DQLRPRPNVARPNMTLESEIANYQYRVGPGDVLNVTVWDHPELTTPAGQYRSSSDTGNWV
QPDGTMFYPYIGKVHVVGKTLAEIRSDITGRLATYIADPQVDVNIAAFRSQKAYISGQVN
KSGQQAITNVPLTILDAINAAGGLTDTADWRNVVLTHNGREERISLQALMQNGDLNQNRL
LYPGDILYVPRNDDLKVFVMGEVKKQSTLKMDFSGMTLTEALGNAEGIDMTTSNASGIFV
IRPLKGEGGRNGKIANIYQLDMSDATSLVMATEFRLQPYDVVYVTTAPVSRWNRLINQLL
PTISGVRYMTDTASDIHNW
              
                            

Download fasta file
RegulonDB