RegulonDB RegulonDB 10.9: Amino acid Sequence
putative serine/threonine-protein kinase YegI Amino Acid Sequence


Size: 648

Fasta

 

>protein kinase YegI E. coli K12. Version NC_000913.3 GI:556503834
MKTNIKVFTSTGELTTLGRELGKGGEGAVYDIEEFVDSVAKIYHTPPPALKQDKLAFMAA
TADAQLLNYVAWPQATLHGGRGGKVIGFMMPKVSGKEPIHMIYSPAHRRQSYPHCAWDFL
LYVARNIASSFATVHEHGHVVGDVNQNSFMVGRDSKVVLIDSDSFQINANGTLHLCEVGV
SHFTPPELQTLPSFVGFERTENHDNFGLALLIFHVLFGGRHPYSGVPLISDAGNALETDI
THFRYAYASDNQRRGLKPPPRSIPLSMLPSDVEAMFQQAFTESGVATGRPTAKAWVAALD
SLRQQLKKCIVSAMHVYPAHLTDCPWCALDNQGVIYFIDLGEEVITTGGNFVLAKVWAMV
MASVAPPALQLPLPDHFQPTGRPLPLGLLRREYIILLEIALSALSLLLCGLQAEPRYIIL
VPVLAAIWIIGSLTSKAYKAEVQQRREAFNRAKMDYDHLVRQIQQVGGLEGFIAKRTMLE
KMKDEILGLPEEEKRALAALHDTARERQKQKFLEGFFIDVASIPGVGPARKAALRSFGIE
TAADVTRRGVKQVKGFGDHLTQAVIDWKASCERRFVFRPNEAITPADRQAVMAKMTAKRH
RLESALTVGATELQRFRLHAPARTMPLMEPLRQAAEKLAQAQADLSRC
              
                            

Download fasta file
RegulonDB