RegulonDB RegulonDB 10.8: Amino acid Sequence
protein-serine/threonine phosphatase PphC Amino Acid Sequence


Size: 253

Fasta

 

>protein-serine/threonine phosphatase PphC E. coli K12. Version NC_000913.3 GI:556503834
MSWRLVYASTVGTSHISADLPCQDACQMQIAWLNDQQPLLSVFVADGAGSVSQGGEGAML
AVNEAMAYMSQKVQGGELGLNDVLATNMVLTIRQRLFAEAEAKELAVRDFACTFLGLISS
PDGTLIMQIGDGGVVVDLGHGLQLPLTPMAGEYANMTHFITDEDAVSRLETFTSTGRAHK
VAAFTDGIQRLALNMLDNSPHVPFFTPFFNGLAAATQEQLDLLPELLKQFLSSPAVNERT
DDDKTLALALWAE
              
                            

Download fasta file
RegulonDB