RegulonDB RegulonDB 10.9: Amino acid Sequence
IPR002035 domain-containing protein YegL Amino Acid Sequence


Size: 219

Fasta

 

>IPR002035 domain-containing protein YegL E. coli K12. Version NC_000913.3 GI:556503834
MSEQITFATSDFASNPEPRCPCILLLDVSGSMNGRPINELNAGLVTFRDELLADPLALKR
VELGIVTFGPVHVEQPFTSAANFFPPILFAQGDTPMGAAITKALDMVEERKREYRANGIS
YYRPWIFLITDGAPTDEWQAAANKVFRGEEDKRFAFFSIGVQGADMKTLAQISVRQPLPL
QGLQFRELFSWLSSSLRSVSRSTPGTEVVLEAPKGWTSV
              
                            

Download fasta file
RegulonDB