RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1508 domain-containing protein YegP Amino Acid Sequence


Size: 110

Fasta

 

>DUF1508 domain-containing protein YegP E. coli K12. Version NC_000913.3 GI:556503834
MAGWFELSKSSDNQFRFVLKAGNGETILTSELYTSKTSAEKGIASVRSNSPQEERYEKKT
ASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKDNT
              
                            

Download fasta file
RegulonDB