RegulonDB RegulonDB 10.9: Amino acid Sequence
prophage P2 late control protein OgrK Amino Acid Sequence


Size: 72

Fasta

 

>prophage P2 late control protein OgrK E. coli K12. Version NC_000913.3 GI:556503834
MFHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYESVQRYIVKPGEVHVVRP
HPLPSGQQIMWM
              
                            

Download fasta file
RegulonDB