RegulonDB RegulonDB 10.9: Amino acid Sequence
phage protein D Amino Acid Sequence


Size: 72

Fasta

 

>phage protein D E. coli K12. Version NC_000913.3 GI:556503834
MRVAEFSISLATGRADIYTETPVKVSGFKRVIDEQDWTITKVTHFLNNSGFTTSLELEVR
LSDVGYETEDNE
              
                            

Download fasta file
RegulonDB