RegulonDB RegulonDB 10.9: Amino acid Sequence
putative tagatose-1,6-bisphosphate aldolase 2 chaperone Amino Acid Sequence


Size: 420

Fasta

 

>tagatose-1,6-bisphosphate aldolase 2 subunit GatZ E. coli K12. Version NC_000913.3 GI:556503834
MKTLIARHKAGEHIGICSVCSAHPLVIEAALAFDRNSTRKVLIEATSNQVNQFGGYTGMT
PADFREFVFTIADKVGFARERIILGGDHLGPNCWQQENADAAMEKSVELVKEYVRAGFSK
IHLDASMSCAGDPIPLAPETVAERAAVLCFAAESVATDCQREQLSYVIGTEVPVPGGEAS
AIQSVHITHVEDAANTLRTHQKAFIARGLTEALTRVIAIVVQPGVEFDHSNIIHYQPQEA
QPLAQWIENTRMVYEAHSTDYQTRTAYWELVRDHFAILKVGPALTFALREAIFALAQIEQ
ELIAPENRSGCLAVIEEVMLDEPQYWKKYYRTGFNDSLLDIRYSLSDRIRYYWPHSRIKN
SVETMMVNLEGVDIPLGMISQYLPKQFERIQSGELSAIPHQLIMDKIYDVLRAYRYGCAE
              
                            

Download fasta file
RegulonDB