RegulonDB RegulonDB 10.9: Amino acid Sequence
putative sugar kinase YegV Amino Acid Sequence


Size: 321

Fasta

 

>putative sugar kinase YegV E. coli K12. Version NC_000913.3 GI:556503834
MSGARLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIA
VALKRLGIEAGNALPLGQGVWAEMIRNRMAKEGLISLIDNAEGDNGWCLALVEPDGERTF
MSFSGVENQWNRQWLARLTVAPGSLLYFSGYQLASPCGELLVEWLEELQDVTPFIDFGPR
IGDIPDALLARIMACRPLVSLNRQEAEIAAERFALSAEITTLGKQWQEKFAAPLIVRLDK
EGAWYFSNDASGCIPAFPTQVVDTIGAGDSHAGGVLAGLASGLPLADAVLLGNAVASWVV
GHRGGDCAPTREELLLAHKNV
              
                            

Download fasta file
RegulonDB