RegulonDB RegulonDB 10.9: Amino acid Sequence
putative glycosyl hydrolase YegX Amino Acid Sequence


Size: 272

Fasta

 

>putative hydrolase E. coli K12. Version NC_000913.3 GI:556503834
MQLRITSRKKLTSLLCALGLISIVAIYPRQTVNFFYSTAVQITDYIHFYGYRPVKSFAIR
IPASYTIHGIDVSRWQERIDWQRVAKMRDNGIRLQFAFIKATEGEKLVDPYFSRNWQLSR
ENGLLRGAYHYFSPSVSASVQARLFLQTVDFSQGDFPAVLDVEERGKLSAKELRKRVSQW
LKMVEKSTGKKPIIYSGAVFYHTNLAGYFNEYPWWVAHYYQRRPDNDGMAWRFWQHSDRG
QVDGINGPVDFNVFNGTVEELQAFVDGIKETP
              
                            

Download fasta file
RegulonDB