RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2542 domain-containing protein YeiS Amino Acid Sequence


Size: 79

Fasta

 

>DUF2542 domain-containing protein YeiS E. coli K12. Version NC_000913.3 GI:556503834
MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA
YIGFGILSIGMIVYLIFYR
              
                            

Download fasta file
RegulonDB