RegulonDB RegulonDB 10.9: Amino acid Sequence
NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Amino Acid Sequence


Size: 412

Fasta

 

>NAD-dependent dihydropyrimidine dehydrogenase subunit PreT E. coli K12. Version NC_000913.3 GI:556503834
MPQQNYLDELTPAFTSLLAIKEASRCLLCHDAPCSQACPAQTDPGKFIRSIYFRNFKGAA
ETIRENNALGAVCARVCPTEKLCQSGCTRAGVDAPIDIGRLQRFVTDFEQQTGMEIYQPG
TKTLGKVAIIGAGPAGLQASVTLTNQGYDVTIYEKEAHPGGWLRNGIPQFRLPQSVLDAE
IARIEKMGVTIKCNNEVGNTLTLEQLKAENRAVLVTVGLSSGSGLPLFEHSDVEIAVDFL
QRARQAQGDISIPQSALIIGGGDVAMDVASTLKVLGCQAVTCVAREELDEFPASEKEFTS
ARELGVSIIDGFTPVAVEGNKVTFKHVRLSGELTMAADKIILAVGQHARLDAFAELEPQR
NTIKTQNYQTRDPQVFAAGDIVEGDKTVVYAVKTGKEAAEAIHHYLEGACSC
              
                            

Download fasta file
RegulonDB