RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidoglycan DD-endopeptidase/peptidoglycan LD-carboxypeptidase Amino Acid Sequence


Size: 188

Fasta

 

>peptidoglycan DD-endopeptidase/peptidoglycan LD-carboxypeptidase E. coli K12. Version NC_000913.3 GI:556503834
MVKSQPILRYILRGIPAIAVAVLLSACSANNTAKNMHPETRAVGSETSSLQASQDEFENL
VRNVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEM
GKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNE
ARRVLSRS
              
                            

Download fasta file
RegulonDB