RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF2135 domain-containing protein YfaP Amino Acid Sequence


Size: 258

Fasta

 

>DUF2135 domain-containing protein YfaP E. coli K12. Version NC_000913.3 GI:556503834
MRKIFLPLLLVALSPVAHSEGVQEVEIDAPLSGWHPAEGEDASFSQSINYPASSVNMADD
QNISAQIRGKIKNYAAAGKVQQGRLVVNGASMPQRIESDGSFARPYIFTEGSNSVQVISP
DGQSRQKMQFYSTPGTGTIRARLRLVLSWDTDNTDLDLHVVTPDGEHAWYGNTVLKNSGA
LDMDVTTGYGPEIFAMPAPIHGRYQVYINYYGGRSETELTTAQLTLITDEGSVNEKQETF
IVPMRNAGELTLVKSFDW
              
                            

Download fasta file
RegulonDB