RegulonDB RegulonDB 10.9: Amino acid Sequence
tandem DUF2300 domain-containing protein YfaQ Amino Acid Sequence


Size: 549

Fasta

 

>tandem DUF2300 domain-containing protein YfaQ E. coli K12. Version NC_000913.3 GI:556503834
MNWRRIVWLLALVTLPTLAEETPLQLVLRGAQHDQLYQLSSSGVTKVSALPDSLTTPLGS
LWKLYVYAWLEDTHQPEQPYQCRGNSPEEVYCCQAGESITRDTALVRSCGLYFAPQRLHI
GADVWGQYWQQRQAPAWLASLTTLKPETSVTVKSLLDSLATLPAQNKAQEVLLDVVLDEA
KIGVASMLGSRVRVKTWSWFADDKQEIRQGGFAGWLTDGTPLWVTGSGTSKTVLTRYATV
LNRVLPVPTQVASGQCVEVELFARYPLKKITAEKSTTAVNPGVLNGRYRVTFTNGNHITF
VSHGETTLLSEKGKLKLQSHLDREEYVARVLDREAKSTPPEAAKAMTVAIRTFLQQNANR
EGDCLTIPDSSATQRVSASPATTGARTMTAWTQDLIYAGDPVHYHGSRATEGTLSWRQAT
AQAGQGERYDQILAFAYPDNSLSRWGAPRSTCQLLPKAKAWLAKKMPQWRRILQAETGYN
EPDVFAVCRLVSGFPYTDRQQKRLFIRNFFTLQDRLDLTHEYLHLAFDGYPTGLDENYIE
TLTRQLLMD
              
                            

Download fasta file
RegulonDB