RegulonDB RegulonDB 10.8: Amino acid Sequence
putative macroglobulin family protein, N-terminal fragment Amino Acid Sequence


Size: 1534

Fasta

 

>putative macroglobulin family protein, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MDTQRFQSQFHWHLSFKFSGAIAACLSLSLVGTGLANADDSLPSSNYAPPAGGTFFLLAD
SSFSSSEEAKVRLEAPGRDYRRYQMEEYGGVDVRLYRIPDPMAFLRQQKNLHRIVVQPQY
LGDGLNNTLTWLWDNWYGKSRRVMQRTFSSQSRQNVTQALPELQLGNAIIKPSRYVQNNQ
FSPLKKYPLVKQFRYPLWQAKPFEPQQGVKLEGASSNFISPQPGNIYIPLGQQEPGLYLV
EAMVGGYRATTVVFVSDTVALSKVSGKELLVWTAGKKQGEAKPGSEILWTDGLGVMTRGV
TDDSGTLQLQHISPERSYILGKDAEGGVFVSENFFYESEIYNTRLYIFTDRPLYRAGDRV
DVKVIGREFHDPLHSSPIVSAPAKLSVLDANGSLLQTVNVTLDARNGGQGSFRLPENAVA
GGYELRLAYRNQVYSSSFRVANYIKPHFEIGLALAKKEFKTGEAVSGKLQLLYPDGEPVK
NARVQLSLRAQQLSMVGNDLRYAGRFPVSLEGSETVSDASGHVALNLPAADKPSRYLLTV
SASDGAAYRVTTTKEILIERGLAHYSLSTAAQYSNSGESVVFRYAALESSKQVPVTYEWL
RLEDRTSHSGELPSGGKSFTVNFAKPGNYNLTLRDKDGLILAGLSHAVSGKGSTAHTGTV
DIVADKTLYQPGETAKMLITFPEPIDEALLTLERDRVEQQSLLSHPANWLTLQRLNDTQY
EARVPVSNSFAPNITFSVLYTRNGQYSFQNAGIKVAVPQLDIRVKTDKTHYQPGELVNVE
LTSSLKGKPVSAQLTVGVVDEMIYALQPEIAPNIGKFFYPLGRNNVRTSSSLSFISYDQA
LSSEPVAPGATNRSERRVKMLERPRREEVDTAAWMPSLTTDKQGKAYFTFLMPDSLTRWR
ITARGMNGDGLVGQGRAYLRSEKNLYMKWSMPTVYRVGDKPAAGLFIFSQQDNEPVALVT
KFAGAEMRQTLTLHKGANYISLTQNIQQSGLLSAELQQNGQVQDSISTKLSFVDNSWPVE
QQKNVMLGGGDNALMLPEQASNIRLQSSETPQEIFRNNLDALVDEPWGGVINTGSRLIPL
SLAWRSLADHQSAAANDIRQMIQDNRLRLMQLAGPGARFTWWGEDGNGDAFLTAWAWYAD
WQASQAIGVTQQPEYWQHMLDSYAEQADNMPLLHRALVLAWAQEMNLPCKTLLKGLDEAI
ARRGTKTEDFSEEDTRDINDSLILDTPESPLADAVANVLTMTLLKKAQLKSTVMPQVQQY
AWDKAANSNQPLAHTVVLLNSGGDATQTAAILSGLTAEQSTIERALAMNWLAKYMATMPP
VVLPAPAGAWAKHKLTGGGEDWRWVGQGVPDILSFGDELSPQNVQVR*REPAKMAQQSNI
PVTVERQLYRLIPGEEEMSFILQPVTSNEIDSDALYLDEITLTSEQDAVLRYGQVEVPLP
PGADVERTTWGISVNKPNAAKQQGQLLEKARNEMGELAYMVPVKELTGTVTFRHLLRFSQ
KGQFVLPPARYVRSYAPAQQSVAAGSEWTGMQVK
              
                            

Download fasta file
RegulonDB