RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF1175 domain-containing protein YfaT Amino Acid Sequence


Size: 207

Fasta

 

>DUF1175 domain-containing protein YfaT E. coli K12. Version NC_000913.3 GI:556503834
MRHGLLALICWLCCVVAHSEMLNVEQSGLFRAWFVRIAQEQLRQGPSPRWYQQDCAGLVR
FAANETLKVHDSKWLKSNGLSSQYLPPEMTLTPEQRQLAQNWNQGNGKTGPYVTAINLIQ
YNSQFIGQDINQALPGDMIFFDQGDAQHLMVWMGRYVIYHTGSATKTDNGMRAVSLQQLM
TWKDTRWIPNDSNPNFIGIYRLNFLAR
              
                            

Download fasta file
RegulonDB