RegulonDB RegulonDB 10.10: Amino acid Sequence
putative transporter YfaV Amino Acid Sequence


Size: 429

Fasta

 

>putative transporter YfaV E. coli K12. Version NC_000913.3 GI:556503834
MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVRTLLRAAEAG
FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV
IEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRV
WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSD
KTGERRNVAALTLLAAGIGIGLSGLLSPVMAIVALCVAAIGFIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAVIGSLIIFTLRVNRT
VAQTDVAHH
              
                            

Download fasta file
RegulonDB