RegulonDB RegulonDB 10.9: Amino acid Sequence
putative lipopolysaccharide core heptose(II)-phosphate phosphatase Amino Acid Sequence


Size: 200

Fasta

 

>putative lipopolysaccharide core heptose(II)-phosphate phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MLAFCRSSLKSKKYIIILLALAAIAGLGTHAAWSSNGLPRIDNKTLARLAQQHPVVVLFR
HAERCDRSTNQCLSDKTGITVKGTQDARELGNAFSADIPDFDLYSSNTVRTIQSATWFSA
GKKLTVDKRLLQCGNEIYSAIKDLQSKAPDKNIVIFTHNHCLTYIAKDKRDATFKPDYLD
GLVMHVEKGKVYLDGEFVNH
              
                            

Download fasta file
RegulonDB