RegulonDB RegulonDB 10.9: Amino acid Sequence
undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase Amino Acid Sequence


Size: 322

Fasta

 

>undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase E. coli K12. Version NC_000913.3 GI:556503834
MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE
ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG
YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER
STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG
SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT
DVRARPRYFVQQVIRPSSKENE
              
                            

Download fasta file
RegulonDB